dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A165N3T1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A165N3T1|A0A165N3T1_9EURY) Phosphoribosylaminoimidazolesuccinocarboxamide synthase {ECO:0000313|EMBL:KZX49559.1} KW=Complete proteome OX=1622207 OS=Haloarcula sp. K1. GN=AV929_17760 OC=Haloarcula.
Sequence length 344
Sequence
MTSVKEFRVDEPATAEDLGRGAFVFTDDYSVFDWGKMPDRIPDKGASLCTMGAYNFQLLE
ENHVPTHYEGVRLPDSDEVLDLGEALSADAAPEEMVIELTQVPDLPFEDGRYDYDAYHGA
ADENYLIPLEIVFRNRVGVGSSLRSRTEPADHGLDYDTWPEEVVDLDEPIVEFSTKYEEQ
DRYLDREAADRIAGTASIDRLEELARAVNHIVTQQAAEADLVHEDGKIECLYYDGEIRVA
DVVGTFDENRFSYGGQQVSKEVIRQYHKRTQPEWVEAVSEAKEQADAESVADWKSLCAES
PEPLDEDVIQVARDLYCAGTNAYIGGDVFDAPSLDEAVSAAGEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]