dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A167NG32 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A167NG32|A0A167NG32_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KZN68202.1} KW=Complete proteome OX=1365248 OS=Pseudoalteromonas luteoviolacea CPMOR-1. GN=N473_07195 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 740
Sequence
MIKTLIKTSLIATLGALTLPSHSHTHVENNIRAQQPNNLNYSLYFSNEDQRVTYSRQYHG
QIVESLHNALVVSLSEQEFLLARSSGAVILEHTPPKTINRAANELVNANQSILTTTQTSG
IPNFPCYPTLEETYELAEQLAKKYPNFVELKHIGQSWKKEQGLGGHDLTVLVIKNKKRNK
NKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRTNPDIKWILNQREIHILLIANPDG
RKYAELGKEWRKNTNTAYCATNEEQIGADLNRNFDFAWNSTPYSSDEQCSNTYQGPVAAS
EPETKVIQNYINSIFEDNRGDLDTDAAPLDTAGLFLDIHSFGGMVMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYVAYQVGNRFHVGGSAGGYAYGQLGVASFTYELGREFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
NQSYTPLPPSQAVKKVKLVIKKQGEGVVQKLKLPAADGIYDSPREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNKAPVADFIPTCTYGSCQFDASKSTDDKP
GLKYRWFIGSEISREEYTGEKIEYVHEMAGTYYVTLVVEDANDISAVKHAVFDLDGKYVP
IANFTYQCAGLICEFDSSSASDPDGHIVERLWRFGADAMYLPGKVKETFTFPTAGEYRVA
FVVRDNDGQYNETYQFITVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]