dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A178VIT7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A178VIT7|A0A178VIT7_ARATH) Uncharacterized protein {ECO:0000313|EMBL:OAP05776.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At3g15370 OC=Arabidopsis.
Sequence length 343
Sequence
MDAQYQDLPPLKRLRLLQRDLEAAQQHQLPNQPEMKSLQLPAKKRKQTRVDYDDDDAENS
NPTYHCLPAKKRIWAIDPDLLSGGGNPFSPFDLNVEYKPYVEEKSIEKKSTLNVESSLEV
EEDDDKENIDPLGKGKALDLSDREVEDEDGIMCAVCQSTDGDPLNPIVFCDGCDLMVHAS
CYGNPLVKAIPEGDWFCRQCLSSKNREKIFSCCLCTTKGGAMKPTNDGRWAHITCALFVP
EVYFEDPEGREGICCSEVLSKRWKDRCYLCKVRRGCVIECSEMRCKLAFHVTCGLKEDLC
IEYREGKKSGGIVVGFCNEHTKLWERQQESGKYKIVAREEDKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]