dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A183U4W2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A183U4W2|A0A183U4W2_TOXCA) Uncharacterized protein {ECO:0000313|WBParaSite:TCNE_0000353201-mRNA-1} KW=Complete proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN= OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence length 213
Sequence
MAVIFLYVLFNFLNFFFPKSSKFLSPIPSLFLRDPTSSVVLFTIAGFIEASYLNCSSRLH
QYLNHFLNLANGWIDSVRTFLLDSKWYIAALKGKCKRGEAIKCGDKIRLMHLTTKCLLHS
HMFNAPLSRGNQEVSCFGKNGEGDTGDHWIVTCNTDEWLRGEPQTAADLCGIQTCPFITR
GAVSRKVEVKGGTRITGPYFTCSGLSLLVPFGC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]