dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1A0DDZ7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1A0DDZ7|A0A1A0DDZ7_ACEPA) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome OX=438 OS=Acetobacter pasteurianus (Acetobacter turbidans). GN=SRCM100623_00816 OC=Acetobacteraceae; Acetobacter.
Sequence length 249
Sequence
MSLSRLSVELIPRSAEALAADVATVKAAFPAADTLNIPDLMRFPLRSWDAAALVRPQFGN
VIPHIRAIDIAPDAPLPGADQPGLEEILVVHGDPPADLSHRTYPNSTESIIRRYRREAPH
LKVYAAFDPYRRAPWKELEDVARKKEAGAIGFFTQPVFDLKLFDLCREWMQGECVFWGLS
PVIGPKSRSYWETTNHIVFPRDFSPTLDANIQFAQTVLKELAQEKGKAYLMPVRIKLEQY
LPALLDAVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]