dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1B7LPV4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1B7LPV4|A0A1B7LPV4_LACRE) Protein kinase {ECO:0000313|EMBL:OAV46608.1} KW=Complete proteome OX=1598 OS=Lactobacillus reuteri. GN=A9P83_00890 OC=Lactobacillus.
Sequence length 634
Sequence
MNPGYEIGHRYRIIRSLGEGGMANVYLAHDMVLDRDVSVKLLRLDLRDDPSTKRRFHREA
MAATQLNDPHIVGIYDVGEDHGLQYMVMQYVKGTDLKAYIKKHYPIPLPQVIDIMEQVLS
AVATAHAHGIIHRDLKPQNILIDENKNVKITDFGIAVAVSQDSLTQTNTLMGSVHYLSPE
QARGSIATKQSDIYSLGIILFELLTGKVPFEGETAVSIALKHFREEIPSVREQNKEIPQA
LENVIIKATAKEPAERYSSVNEMAADLKTVLDPERANEPRLKIQQDDNGETKVLDIKHLK
ADDYQPKKSTDSPTVDPSTKPQKWKKYGIVSGTLGMIVLIAVCSWWFLIRQVIIPDVEGM
TVQKAEQRLHQQNLRIGKITLVNSQAVDKNRIVSTNPDVSHKTRVSTPINLTVSTGVKQL
QMADYVGDDYSSVAANLRRKGFQVHQEPVYSDDIDKGQIIRQNHKKGTIVKPAANTIIFR
VSAGKEPIKIPNFKNQDISAVQQFANKNNLQLTTQEKKSKIIATNHVINQTPRAGSTLNH
GDTLTVSIANSGNQTKTTNIQINIPFDGNGGQRENRVQVYIRDANHNLTMEYQDITINQE
TTINVPFTLKQGETGAYRVVRNGRTIMSATNITG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]