dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1B7UFA2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1B7UFA2|A0A1B7UFA2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OBP13157.1} KW=Complete proteome; Reference proteome OX=1827365 OS=Rheinheimera sp. SA_1. GN=A5320_20160 OC=Chromatiaceae; Rheinheimera.
Sequence length 761
Sequence
MHKMYWLTSLFISYPLYAAPLLDDPRLQDFQQQQLQQATEVRFATVELARAAAISHHDVL
LAGHWKDKVLVLQLDNKAKLQLTPFAVAMTPATQWQTAQAAAFSQSNNRSDSSQANQAQA
GISGFPCYETVEESYAIAEQLVRDYPNYASWQPIGPAWAKSNGRPGYDLHVLKLSKNNGV
ANKPVLLINSAIHAREYATAPLMLAFAKSVLEGIGNNADADWMLEQQEIHLLLQTNPEGR
KIAEGGLLWRKNINDASCSSGNYGVDLNRNFSFGWNSAPGGSSGDSCDLTYRGVSAGSEP
ETQALQQYARAVFKDNRGPLRSDAAPATTSGIHLDIHSYSELVLWPWGENASPAPNAAAL
QTLGRKFAWFNDYLPTQSIGLYPTDGTTDGVSYGELGVAAYTFEIGTAFFQSCAVYQNQI
LPDNLKALWYAARVTAAPYLLPSGPEVQGLTMNTVDGKVRQDQSLTLQFQLTDRQTNLQN
GIEPSQPISKAELFINQFPTESATADVVLSAQDGAFDNAVEMVNGTLTSLPLGKHRLYLR
GTDASGQAGPVYASYVEVTPAQEDPLISLDFSVQCQFLRCSFRNLSQIATGSNLVFSWQF
AAGQSSQSAAPEFVFSAAGSYPVSLSTVSLGQPRVVTKTVTVFAEPQVSFSSSCNNLVCD
FTASASSGNGAIVQYNWQLGSVVASGNPLRFTFSGAGSYPVTLTVQDAAGQQANSSQTLT
VTAPPPPPPAAAGKSSGGSWPAVFSLGLWWLYLARRHRSCR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]