dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1D2MIX3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1D2MIX3|A0A1D2MIX3_ORCCI) Regulator of G-protein signaling loco {ECO:0000313|EMBL:ODM92977.1} KW=Complete proteome; Reference proteome OX=48709 OS=Orchesella cincta (Springtail). GN=Ocin01_13704 OC=Orchesella.
Sequence length 1284
Sequence
MDIPSSPSPVPQHGMRRRKKRSTPTNTVPGSSLTGLNRGSIRIVELIRGSLGYGFTISGQ
KPCLLRCIVEGSPADRAGLRPGNCLVGVNNKDVSHLAHDDVVSIIGSCTGLLRLHVADSY
FSESSDDECFQQVQQARPKYPHRPRPVKTVTTSKKLPTYTKMPSMDIASEEKIPIKSIQC
PKSPESLHRSTSPSARRASWDPLMPSPRRIPRPPYLCDEESPIPAIPPRSQNVPSTSYQK
TVNPNVEIIRVFGHLESPSGSSCSSSSKMTPITKLVTAPLFSPASTSNDRFNTHSSSGSS
SRRENANIRKPGNHTVRQIPDPSETSESNYQAVVGYIGSVEIPEVHENKRLQAISACVKK
LRQEKRVRSIVLLRIQSNGISLFSSNQNVQNGPPLAFYSSSIIAFCGAYGDDRRFFGLVT
STGSRKNYSCHVFMVEPKLLSHLEHTRRARCFGIQCTALSVPKSGQVLGLQECAEFPATA
DSILNSILRLHRASDEITPRSPSEASTRLESTNSSNSDSGIGFRDDCDRNSAQIYDILEH
DTNSELKPPCRSPQLRRHTSPNLRKSLPSVGSYALSTHDCVMQMQSRCASKEPGKVRVPS
TSYQHAELFGHSSFDSDPKSLQEILCTSADRVRGAREMPSTSKAIGHSSRDRLSLDGSNR
QPPPPIEVSVLVTPTRGREKRQSMDRMTPVVDEDFSKSNPNRASRASIARHGTRSLENLC
IPDDEVPNPLECRNSIGSSTPALNQDLKNSSSGVEWEFKVPKPPKPKMDGNRAKKWAESI
EKLLSDPGGSQVFTEFLQHEFSAENIHFYTECLMFKEAFPSLTQSQRISTASTIFQKYLQ
NGATDPVNVDFQARCQCEKALYQPTQDMFDSTLAQVFNLLKFDCYPRFLRSDIFRDYSSG
TLALPPLPGEQSDSDQESVKSRKLSLDGRRRSLLPWNIKNRSKKSKAKGDPDGLNSDLSF
IQQAALNPSCDGSDQDDGFRRQSYKICRVVLPDNSTTVVPCIPGETLGAVVQKLLKKREF
HYSAFEVVSASSGKTLDVNMQVTDMTTREIKVEPRAFIGIELPHGWKVGVRANPNRKVAE
VLKPILSQHSLKLDAVVVYDLETCEILDTKCPMGKLDSHNLLVKSKAEAKLEEITNHIRE
FGTFDHPFVDDDQISAKTSSSQASSVFRDFLRRSSKKYKRKNKGGCQYNSLEDPAKDPAN
ELHGGLRSDIESEPERAPTPLTKLSDEENSLPPQYLASSHPHLSVVKSTPESPLSLVPSE
LNLAENSRNRKPIYISQTTNSKES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]