dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1D6F4E9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1D6F4E9|A0A1D6F4E9_MAIZE) B3 domain-containing transcription repressor VAL2 {ECO:0000313|EMBL:ONM26207.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d007173 OC=Zea.
Sequence length 961
Sequence
MAMAAAAAAATKRCMNPACGAPASVLGAGGDWRKGWPLRSGCFALLCDKCGLAYEQFVFC
DIFHQKESGWRDCSFCGKRLHCGCVASKNSYDLLDSGGVHCVTCMKNSLAQSASGQVVPK
LFPSPINLRFFGKSDELLSSRNFEQPPSLTLDSRNDDIAFVNKSNHLFMVKGIEAGQSSN
ILRQKEIENGSRQIKWEQPTLSFGDMGRPFLTRSQSALESPQCTRRDDNKDPTTDSTSES
FSEACLSMSLGIANNVNRMEATSTAERPVLLSTTAIAEGRELATTLSPFQHAQRARHFLT
RPPRIGEGAAFDPTRDMFPHLRVARPPADGRGRNQLLPRYWPRITDQELQQISGDSNSTI
VPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGRPLTIQDARGKEWHFQFRFWPN
NNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIDPGGKLVMGFRKATNTVSLPDSQISAIAN
GSLLSETLFSTANENIGVVSGYPGFLHSIKGAADLHPNSLYDHHMNLVDGDVSWNKADKF
GSRPDEGSLQFLQKRSHNIGSKSRRFLIDAEDAMELKLTWEEAQELLRPAPTAKPTVVMI
EDYEFEEYDEPPVFAKRSIFTIRATGEQDQWIQCDDCSKWRRLPLNVIVAPKWTCTDNSW
DSKCCSCSAPEELTPRELQSVLQQYEEMRRRKGSYGLKLNVAEMDASSLDAFATAAVFGE
VGNQGSASVATTTKHPRHRPGCTCIVCIQPPSGKGPKHSPACTCNVCMTVRRRFKTLMMR
KKQRQSEREEAEAGKKIAWVNRDEPEGSSLSRSPQTLDSTRDNSDVTATMLDKVSDVNKQ
GHIDVDLNLHPAAPAVQAAQQQPRPVSMMGLLEVAGRPLDNYMKQNGLTSLVGEQGGGSS
STATVPPPALVESEERTSNEGLVPSASAEREPNAMAVDEAGENQQDKAADDDDDAVAAAA
T

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]