dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1E3J4W2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1E3J4W2|A0A1E3J4W2_9TREE) F-actin capping {ECO:0000313|EMBL:ODN94991.1} KW=Complete proteome OX=1295532 OS=Cryptococcus depauperatus CBS 7855. GN=L204_04336 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence length 445
Sequence
MSEISLEEKCRLASTLIGQTPPGEINDVINDIRAIIDNDDALMPHVLPALRAYNLSQLHV
VEHPENNNIPLHTARLAFAAILPGVETERYVDTVGKQSFAFDHLTFVVSDYQPYKLPEKE
EAFRSDLAKSLEAYAKNHFPSGYSSVTCSQIPLRPKSSTPAAPKPAAEAGVAGEALKEPR
EESTAAEGISNAERKPAAANVPVTDVIPEQVNSGDLEPAPTPAEDTAEKEGIQEPGDLER
VDAAVKKVNENQEQEDVVQKIDDDSEPKIEEEIAYMKPQDTSEDTEVDLEDKFTGLSVEE
EQQERIENPIYTLEIVGNRYNIDNFWTGRWRTRWIVDQAACKVNGVINVDVHYYEQGNVQ
LATNHTVSFPYPSSASGSQSVVSQIVTTISKIETNYHFELNDVYGKLGDKTFRALRRALP
VTRQKMDWDKVTGYSLGADLSKARS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]