dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1E7XRL4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1E7XRL4|A0A1E7XRL4_9PROT) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome OX=160808 OS=Acidithiobacillus ferrivorans. GN=A4U49_11145 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence length 799
Sequence
MRVSIQWLRELLDTSWDTEEIAQRLTMGGIEVEVVEDAAPAFHGVVVAAIQSVVCHPEAD
KLRVAQVDVGDGRLRTIVCGADNLAVGQRVPLAMPGAGLPGDRDIVIAALRGIASEGMLC
AAAELGLDDGSSGLLILDADAPIGADLRDYLGLDDQVLTLGITPNRGDALSVLGVARDLC
ALGAGTLRNPLEPMAKCSWVTSGPEEGSSTPDDFPVHIATAAQSACPSYTALWIDGVPQR
LPDRLHERLRRAGQRCIHPVVDLLNLHMLETGQPLHAFDAETLQGGLSIRWAQDGEILDA
LDGRDLPLASDMLVIADRAGPVALAGVIGGRRTAVSAQTHSIVLESAFFQPKVIQGRARR
LGLQTDAAMRFERGVDFALAPRVAAAVLTRLAILGKADLRATRSHTVLGQLPEHAPITLR
RARLARILGMDYEDTVVETALTRLGLRVSEIPDGWQAISPSHRFDLHIEADLIEEVGRIY
GYERLPAHRPVGTLQPLAMARGPQPTTLRGILQARDYHEVITYSFISRQAQDVFTPDADA
PALLNPLSTDLAVMRASLWPGLMQALQFNVKRQQDRVRIFELGRVFSANDQHLVLGGCMV
GAADRESWAQPQRAADFYDLKGDVSALLTLWPQTEFSFRPLANHPALHPGQAAEIWVADQ
RVGMLGALHPTLAAECDLDKSPFFFYLDIECLDGLVNVSRFTPLSPFPALRRDMALVIPD
DILAGTVLNVMRLSASGMVKEITIFDRYQGASLMVGTYSLAFALLLQDAERTLTDADVQA
EMDRLLVAVQRLGSIGLRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]