dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1I0CXK0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1I0CXK0|A0A1I0CXK0_NITER) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=915 OS=Nitrosomonas europaea. GN=SAMN05216309_12722 OC=Nitrosomonadaceae; Nitrosomonas.
Sequence length 358
Sequence
MKKISVLIIDDSALIRKLLTEIINARPDMEVIGAAPDPIVAREMIRTLNPDVLTLDVEMP
KMDGLEFLEKLMRLRPMPVVMVSTLTERGSEVTFRALELGAVDFVAKPKMDIRNSLEAYT
DEITGKIRTASTARIHRLEPVASNGAASGSIVQMPRHHGISTEKLIIIGASTGGTEAIKD
VLIHLPPDCPGILITQHMPEGFTRSFAERLDRLCKIRVKEAEGGERVLPGHAYLAPGHSH
LLLKKSGANYVTELSQTDPVNRHRPSVDVLFQSAAHCAGKNAVGVILTGMGKDGAAGMLD
MHHAGAYNLAQDETSCVVFGMPKEAITLGAVDEIVPLQDMARRILARLVGAGKQAVRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]