dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1I1PFJ5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1I1PFJ5|A0A1I1PFJ5_9GAMM) PKD domain-containing protein {ECO:0000313|EMBL:SFD08611.1} KW=Complete proteome; Reference proteome OX=1123010 OS=Pseudoalteromonas denitrificans DSM 6059. GN=SAMN02745724_03437 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 720
Sequence
MTLINALTFAASLTLSSSSPSVYLAEFSDQKQKIKTKISFHHALLASEDDGLLLELTNKE
VRLLEKKGITLTAADKKWQKKLSTIQRRSSANQMGGIPGFNCYETVEETFTEADKLVIQN
PNLAQWIDIGDSWQKINGDKGYDLKVLKIGKQSLIDPPILFIQSAMHAREYTTAALTLDF
AKNLLQNYDSDPDINWILNRHQIHILFQTNPDGRKIAETGVFQRKNVNINHCSQGHTGID
LNRNFSFGWNTVDGGSSGNDCDETYRGTHPASEPEVSAIEAYVRSIYPDVRGESDTDAAP
IDTKGLYLDIHSYSELILWPFGHTETLAPNNKGLQALGRKLAYFNGYDPGQSVGLYPTDG
TSDNLAYGELGIAHITFELGTAFFQSCNIYNNKIKPDNLKALLYAAKAVEAPYLITSGPD
IASIEITDADDIYITIDVLATDEQFSTKGGIEAKQNINKVWYSIGAYPNEENSLQAEIKD
GAADTSKEVFTARIKRDDLVNDQITVYFKGEDSSNSQGPVSAKTLTLSQPIANADINCQG
AKCHLLGKEIANSYLWQLEDGRTSINKATDFIFPSLGSYQATYTVTNSIGLHTTQNYDFT
VTELLKPDIKFSAICSNITCKFDASDTIDLDSDNLIYKWDFGDSTYSDTMVTSHDYASTG
NFTVTLTVTDEHNQTSVLTQEIITTQVVTQEPTLEKTQSSGGSFIYNLLILIVFLRVKHK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]