dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1I3U2T7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1I3U2T7|A0A1I3U2T7_9EURY) Transposase {ECO:0000313|EMBL:SFJ76071.1} KW=Complete proteome OX=44930 OS=Natronobacterium gregoryi. GN=SAMN05443661_1841 OC=Natronobacterium.
Sequence length 367
Sequence
MGGDRRGELVRHLSEEELDRLLDEADDPKVVKRLTFVKRLYKGATYEEAADDVGKSASTG
SRWARRWNDGGLGQLTPNFGGGRPPKLGDEEQECLLELLREGQPWKAQEVHQLLDEEFDV
EYHPDYLGRFLRNLGLSYAKPRPKRPSRPENADEILEERVADAFDEETETAHNKRPEDED
EGWVLDDDICTDGGTIVGFCDASHPQPYDNSHRLWYVDDPTLERPLVKLDEPAVGCYTLN
GESVLTFPEDQSKENICALLEEVREQNPGTRILLVLDNFSSHICEHTRKRAHQLGIDLVF
LPVGSPHLNPIEQVWKVLKRNASPIVVASESAFRTLARRLFNTLTDRLGFAKSWIDQFLS
PYLQKLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]