dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1I8HSK6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1I8HSK6|A0A1I8HSK6_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-uti_cns_0007824-snap-gene-0.10-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence length 301
Sequence
MSNNDRQLNHALDLMRRLPPQSVEENLTQLVDLVPNMTESLLCCIDQPLQVSKDFSCGKD
YLLCDYNRDADSHRSPWSNQYFPPLEDGAVPSDRLRTIEIELNSAMQRYRELYYGGGSIA
SAYLWDLDSTAKGFAGAVLIKKCGSSGCSGQWDSVHVIEVTPKVTGRSAKYKLTATVMLR
LVSELRCKSDDVSCDSSEFDIAGSLTRQAERESPAALSSANESAIAAAHIANIGRLIEET
ETSMRQQLIDVYFDNVCGVVETMRTSLSKESRMARELLQRELNEAINRSSPLVSCSKLLT
D

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]