dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1Q6EYK1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1Q6EYK1|A0A1Q6EYK1_9BACT) Pyruvate kinase {ECO:0000256|RuleBase:RU000504} KW=Complete proteome OX=1896970 OS=Alistipes sp. 58_9_plus. GN=BHV65_15600 OC=Alistipes.
Sequence length 491
Sequence
MYRMKKTKIVATMSDFRCTEEFVKNLYDAGMDVVRVNSAHVTEDGATHIVETVHRVNPAI
PIMIDTKGPEIRVTTIADEYGNSINFRVGDRVAVRGSDGSDMTTRKVVYMNVPTIVRDIP
VGARMLIADGELEIRVVEKTDEELICEFVVGGAMRSRKSVNVPAVSIDLPSVTEKDRRFI
EWAVKNDVDFIAHSFVRSAKDIKAVQEILDAHGSKIKIISKIENQEGLDNIDEIIEASYG
IMVARGDLGVELPAEAIPNTQRRIVEKCICAKRPVIIATQMLYSMVKSPRPTRAEVSDVA
SAIYERVDAVMLSDETAMGDYPVESVETMARVAREIERDETHFKPMIDMDMVSVNHEITA
QLARSAVRASTNLPIKYVVLDTKTGRTGRYLAAFRGRKTVMAVCYQLHAQRILALSYGVV
PILRNQELHDKYHFLVDALEFLDQYRKLKGEDLLAIVGGSFGPDGGASYVEIANVDNIRR
RNEEIVAAQKC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]