dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1R3RWJ8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1R3RWJ8|A0A1R3RWJ8_ASPC5) Uncharacterized protein {ECO:0000313|EMBL:OOF98875.1} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_204587 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence length 273
Sequence
MASTIELASSFIEGAPPGELADVVADVKALTSDGPDIIPSLAPAFERYNQSQLATVKLPG
ASQEVLISEYNKLEGNRYFDVESQTSFEVDHITQEASAAQSYVLESQNADFIKSLLKSLS
AHAAEHYRSCSYGVYPIEDDSAVAIVLVANRYSPNNFWNGRFRAIYTLPVGSSTTISGQI
KVDVHYYEDGNVALNTTKPVSLTVPSVDAGAIISKIAAAERDYQEELNRTFVNTAEGAFK
GLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]