dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1S3FB66 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1S3FB66|A0A1S3FB66_DIPOR) Galactose mutarotase {ECO:0000256|PIRNR:PIRNR005096} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Galm OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence length 342
Sequence
MVSVTRTAFGELPSGAGPVEKFRLQSDLLKVDLISWGCTITALEVPDRQGKASDVVLGFA
ELAGYLQKQPYFGAVVGRVANRIAKGAFTLDGKEYRLAINREPNSLHGGLRGFDKVLWTP
QVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELVINYRAQTSHTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDETLIPTGNVAPVQGTAFDLRKPVELGKHLQKFGIN
GFDHNFCLKGSKEKHFCARVQHPGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQSWPDAVNQPHFPPVLLRPGEEYNHTTWFKFSVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]