dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1V4JFD6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1V4JFD6|A0A1V4JFD6_PATFA) Regulator of G-protein signaling 12 isoform A {ECO:0000313|EMBL:OPJ70856.1} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_017209 OC=Patagioenas.
Sequence length 1566
Sequence
MHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKAGDQIFAVNEINVK
KASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWLKPKPDSKALGINR
AEKVVEEMQSGGIFNMIFENPTLCAGSSDHSAPKQRSFSDSAAIKFEAGHESVSYPNLLS
KEEIAKVLNDDSVFRIGLEGAEDFGLDASILNVAMIVGYLGSIELPSTTSNLENESLQAI
RGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFSAVCPDDRRFFGLV
TMQTNDDASLAQDAEGALRTSCHVFMVDPELFHHKIHQGIARRFGLECTADPDTNGCLEF
PTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFNQEEKN
NRVLVVDLGTNPSKHIPNSIWENPVGRGHNQPASHWNGFCHEQEGNIPLEVIQNDKSQNV
SKHLSPSARIEVPLVSSRNSIPPSKKNAAGAGNQRWLPVHVLQEWQHGNVSDQESYTDST
DGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQLKSHKNEWSKKMFCMQNKFGPPHSIRK
SKEDKKGAKFGHPMGLSQAPPPRSSVRRSFGRSKRFSITRSLDDLESATVSDGELNSTDL
KDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPIGVKYFSDFLRKEFSEE
NILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDILNSPHP
DMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRVPSSPTSKHSISSE
KSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLGKSQKRKENGDYPN
DSIQSNGLSYRRESQGSMSSTASLDLSETSRLPAFVPDKEKSPKYCCINLPDGSSSKMAV
KSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLD
LVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQEPLDLGVPISNLDGQR
VVLDEKEPTKGRAFTDKQKGASVKQSATVTTSRNQVSTGEGRTLGKSNSIKMKGENGKNA
REVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLILPDF
LRLPPTGPEPSSSTPAGPKGLNRRVSKSEGKDGCTSPSGKQESVQNFNENSVKKMGYSEN
KHKSALTALHSQKTFSVPFNTALSPIPHAQENNATIWKRQSRELQAEGIQMVDDENVADL
TLVAEGDISSPNSTLLPPPPPTPPSDTSELPEANYPPPTPFAGANHRKKKDSQETSGNSC
KQMSHKAKSSRTFNPPGVRENPGTELPVNRIIDVDGVKLEDTSTRSCDDSEGNLSFEVYI
SELSTTNLGQEEAQNMSSLAHKCLQKMEIYANFLSGMVEGFITRVYQIYFPERNGAQQHI
TMTGTGDGDIALPCLKTTRSAGYDQMPLDVCFPLSNEGETHFPPSPGREFSVRSLIAKLI
AVYQST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]