dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1V8MYP9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1V8MYP9|A0A1V8MYP9_VIBVL) Pseudouridine synthase {ECO:0000256|RuleBase:RU003887} KW=Complete proteome OX=672 OS=Vibrio vulnificus. GN=XM78_c11229 OC=Vibrionaceae; Vibrio.
Sequence length 233
Sequence
MRLDKFLCDALGATRKEATKILKSGEVTVNEQVQKSGAVKVTEECVVEWQGRELAMQGPR
YIMLYKPEGFVCSHEDGFNHTAFVLLDEVKMDELHFAGRLDVDTTGLVLITDDGKWSHRI
TSPKHKCDKTYRVWLADPIGSDYAEKLAEGVQLRNEKELTLPAQMTIVNADENEVLLTIH
EGKYHQVKRMFAALGNKVEQLHRERIGAIELDESLEPGEYRYLTQEEIDSVWK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]