dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1W2W1I3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1W2W1I3|A0A1W2W1I3_CIOIN) pyridoxal 5'-phosphate synthase subunit SNZERR {ECO:0000313|RefSeq:XP_002121070.1, ECO:0000313|RefSeq:XP_009860474.1} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100179166 OC=Phlebobranchia; Cionidae; Ciona.
Sequence length 298
Sequence
MAENHVTGSFTLKTGFAKMMKGGLIMDVINAEQAKIAEAAGACAVMALERVPADIRKMGG
VSRMSDPKMIKEIIAAVSIPVLAKVRIGHMAEAQILEALGVDMVDESEVLTMADEENHID
KHQFKTPFVCGARNLGEALRRISEGAAMIRTKGEAGTGNVVEAVRHARAISRQIRLAQAM
DASELYSFAKEIQAPVELLRETAKLGRLPVVNFAAGGLATPADVSMLMQLGVDGVFVGSG
IFKSNCPKKRADAMVQAVIHYKDPKTLAAISEDLGEAMVGINCEDLKEVWATREAKTN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]