dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A1Y3E8S6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A1Y3E8S6|A0A1Y3E8S6_9BILA) F-actin capping protein alpha subunit {ECO:0000313|EMBL:OUC41513.1} OX=6335 OS=Trichinella nativa. GN=D917_03299 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence length 316
Sequence
MPSEVTTLSVNDKRRIEMANELVSNAPPGEIQEVYNDLRQFLEDDESFTVLSASMFAEHN
KRNFVPVLVEGIEKPVVIFFLLVVALFHFRLHLAFQVIITPFNVLNNGRIYDPRSKQSFE
FDHVKLEAFDRASCPNADVEELESRRLSLQESVDAYISKYFMHGNGSVYSYAEPECDEKK
LLICIVNQQNQPNNFLNGHWQSQFAVQFPKEDELQIDGWIQLKVHYYEDGNVQLFSKKDV
NRTIPFTNEATFANDVVKIVQEEEENFQRNVDQSRRLMSEFNFKGLRRQLPVTRSKIDWS
KMVSYRVATELKPQTP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]