dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A243AT12 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A243AT12|A0A243AT12_BACTU) Sodium-independent anion transporter {ECO:0000313|EMBL:OTY31863.1} KW=Complete proteome OX=180894 OS=Bacillus thuringiensis serovar poloniensis. GN=BK736_25650 OC=Bacillus cereus group.
Sequence length 587
Sequence
MRGLFTERFEGYSLGHFQKDLLSGMIVGVVAIPLAMSFAIASGVKPEYGIYTTCIAGILI
SLFGGSKYQIGGPTGAFVPILLGIVITYGYESLLLAGLLAGIILCLMGIFKLGSLIKFIP
RPVTIGFTSGIAVIIFTGQIASFLGLTGIKKHEEFIANLQEIFTHIGTTNFYSVITALIC
FFVILITPKISPKVPGSLVGVVISTIIATVFFSGHVPTIGTAYGTIPNTLPQFDIPEITL
ERIKQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNKELIGQGIANIVTPLFGGIPA
TGAIARTATNIKSGATSSMSGIIHGVFVLFTLLLLAPYASHIPLASMAPILMVVAWNMSE
QKHFIHILKMKTGDSLVLLVTFLLTVFTSLTTAVEIGLILAVILFTKRMSNMLVISKVLP
DHTRKHEKLLPHVVNKAHDCPQISIYTIEGPLFFGAAQTFEQNILATIHYKPKVLILRMG
KVPFIDTTGESYFRNIVQHFKNQGGVLLISGIQSELKATLDKNRLYAEIGEENFFDHTGE
AINYALGHLNTKKCIGCKHFAFHECIELSQQSQEANTIKNKVNALDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]