dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A290T2A3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A290T2A3|A0A290T2A3_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ATC97681.1} KW=Complete proteome OX=1117319 OS=Pseudoalteromonas spongiae UST010723-006. GN=PSPO_a0468 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 733
Sequence
MLRKLLISAAMLGAANAHAQPSQHYLVTFPNEDIEAKAKISLHHNLIGDRPNGVLFTLSS
EEQSLLKRFGATLQPADNLAKQFLTKQKNIFDKLTNTSTGIPGFSCYATVEETFQQVDDL
VAAHPEYTELVDIGDSWQKQNKGEGYDLKVLKIGKKDLVNPPILFIQSAMHARELATAAL
TLDFAKQLLAERETNADINWILETQQIHILFQTNPDGRKIAETGVSQRKNVNENHCLEAN
VGVDLNRNFSFGWGSVDGGSSGDACSATYRGDSPGSEPEVAAVENYVRSIFPDQRGPNIS
DAAPENTQGLYLDIHSYSQLILWPWGGSYDAAPNAKGLESLGRKLAYFNDYRPMQSVGLY
PTDGTSDNLAYGELGIAHITFELGTAFFQSCGYYGALVKPDNLKALLYAAKVTKAPYQLT
QGPDIADINFALNAQQQIVLKANATDTRFKNNSSWPMQNITKVRFAVNQLVSDDNQQLAT
FSDGNADSITEQFEIVINDNQLIDKKAIVYMQAQDSDGYWGTITAQSIDTNPPSVAGNVV
CSGAKCQFNVENPVSGFNYKWQLSSGDVLEGEEATHILPSLGDYSATLVVTNSIGVSNSL
AIHFNVTELFAPEVVASHRCNYLACEFDASLSTDADSNTLSYTWKAEDASASGKVFSHNF
SQSGSYKVELVVTDEHEQAARYEFDLKVEAEPEPVPLPEVPDDVKKESSGSNSLFMLFIL
TAGALIRRQRVKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]