dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2C5XK53 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2C5XK53|A0A2C5XK53_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:PHH65458.1} KW=Complete proteome; Reference proteome OX=1399860 OS=Ophiocordyceps australis. GN=CDD81_2238 OC=Ophiocordyceps.
Sequence length 281
Sequence
METVDPFDSALDLLRRLNPKHTSQHLNAIISLAPDLTEDLLSSVDQPLAIRRCKQTGRDY
LLCDYNRDGDSHRSPWSNEFDPPLDEAGDGAGGASDGAGEGAIPSERVRKMEIKANEAFD
IYRELYYEGGVSSVYFWNLDDGFAGVVLLKKSATPGGASEGVWDSIHVFEAIERGRTTHY
KLTSTVILTLATSEGALGDVDLSGNMTRQVEQDLPVESDESHIANIGRLVEDMELKMRNL
LQEVYFGKAKDVVGDLRSMGSLSDGARDREAQKEIIGSMKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]