dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2C9V310 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2C9V310|A0A2C9V310_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY38665.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_10G033500 OC=Crotonoideae; Manihoteae; Manihot.
Sequence length 287
Sequence
MTSLAGKSQDEIFTVRRKPTRFFKIILENTIREGKLGIPTKFVKDYGNCLSSPVTLTDPT
GNSWKVDLLKNGNDVWLEKGWPEFSENHSLKYGHFLVFEYKGDSHLHVFIFDESAVEIEY
SGKLNFDGNSPLPKKQEDGDQDIIYLHTTRSGNQSKEKQKQVMAAKGRNWQIERPKSAKT
CGALQAANNFISNYPFFKVLLRRTLDVNVPFSLIRRYMKCESQILMLHVAEKSWPVKLNV
YSNRRIASLARGWTAFARENCLEAGDICIFEMIERNVLNVFMFRCAC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]