dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2D4K6G7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2D4K6G7|A0A2D4K6G7_9SAUR) Uncharacterized protein {ECO:0000313|EMBL:LAB04296.1} OX=1970185 OS=Micrurus paraensis. GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence length 286
Sequence
MADPEDQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPAKIEGYDEQVLITEHGDLGNGKFFDPKNKIAFKFDHLRKEATDPKPHDVENAIESW
RNSIEIAMRAYVKEHYPNGVCTVYGKTIDGHQTIIVCIESHQFQAKNFWNGRWRSEWKFT
VTPSTTQVAGILKIQVHYYEDGNVQLVSHKDIQDSLTVTNETQTAKEFVKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]