dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2H3C0B9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2H3C0B9|A0A2H3C0B9_9AGAR) F-actin capping protein, alpha subunit {ECO:0000313|EMBL:PBK74714.1} KW=Complete proteome; Reference proteome OX=1076256 OS=Armillaria solidipes. GN=ARMSODRAFT_950743 OC=Armillaria.
Sequence length 288
Sequence
MDAKERIDAACSFLLQSPPGEINDVLNDVRNIISDDDSLQEGVLPALREYNLAQFMAVDV
PGTDHQSIVSEAARVDGTERFLDPRSQTSFAFDHLILEASDPQPVDPDEDSEPFRSALEK
ATLQYLSAHFHDGVSSVFSSTSSPNQFVIQVVANKYNPSNYWSGRWRSEYIVDLNEHKVD
GKVLVNVHYYEQGNVQLATTHTVSKTLPSAIVTSSPATSTTKILALIESEEGKFQSILND
TYQDMGEKTFKGLRRALPLTRQKMDWDKVLGYKLGAELSSSKGVFGSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]