dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2H3TXR9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2H3TXR9|A0A2H3TXR9_FUSOX) Probable actin-capping protein alpha-2 chain {ECO:0000313|EMBL:SCO86729.1} KW=Complete proteome; Reference proteome OX=5507 OS=Fusarium oxysporum (Fusarium vascular wilt). GN=FRV6_10856 OC=Fusarium; Fusarium oxysporum species complex.
Sequence length 273
Sequence
MSDLETVSAFVEGAPPGELADVIADIKSLTLETSPDIISNLGPAFEKYNEEQFVTVKLPG
SSQPVIISSHNSLGDGRYYDVESSSSFAFDHTTQKASAVQSHVLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYVLDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTISSVNGASIVREISTTERKYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGGGSSRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]