dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2J6SLN6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2J6SLN6|A0A2J6SLN6_9HELO) F-actin capping protein, beta subunit {ECO:0000313|EMBL:PMD51682.1} OX=1095630 OS=Meliniomyces bicolor E. GN=K444DRAFT_545853 OC=Helotiales; Helotiaceae; Meliniomyces.
Sequence length 284
Sequence
MSEADQFDSALDLLRRLDPKHTSEHLNSVISLVPTLTEDLLSSVDQPLTIARCRKTGRDY
LLCDYNRDGDSYRSPWSGEFETPLGGSGAGGVDDQGNNEGAGEGAVPSERVRKMEVRANE
AFDVYRELYYEGGVSSVYFWNLDDGFAGVVLLKKVATPAGKSQGTWDSIHVFEAVDRART
AHYKLTSTVILHLSTGNDALGEMDLSGNMTRQIESDLPVDDDTSHIANIGKLVEDMELKM
RNLLQEVYFGKAKDVVGDLRSIAPLTEANRDKATHQEMINSMKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]