dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2J7QP75 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2J7QP75|A0A2J7QP75_9NEOP) Uncharacterized protein {ECO:0000313|EMBL:PNF30397.1} KW=Complete proteome OX=105785 OS=Cryptotermes secundus. GN=B7P43_G12863 OC=Termitoidae; Kalotermitidae; Cryptotermitinae; Cryptotermes.
Sequence length 1552
Sequence
MHPIRRRKKRPNYGVRTVEVSRGKNGFGFTISGQQPCILSCIVAGSPAEKAGLRPGDYLV
AVNGQSVSKVPHDDVVRLIGCSSGILKLQIAENYYSDSSDEDAIIPARPKPKYMHKPRNG
GHNQRTTASSQQSRGAKIVRDLRTGAMYEQQVEPSAMLQSPGKSDPPLSQQWEPPVPLPL
PRPRFYPHPQTEESCEQDRDKVEFRALVGYLGTIEMPKKLQPGSRLQVVRSCIKRLRTEK
RAHTLVLMSIHTHSLTLTNCHKVTLAEYPSDRVTFCGTSSDEERRFFGIITTAVRSVEDE
NDGRELVHSSSCHVFAIELRLHGIHGEHAGKADAFSLHCTVDAATGFCTEFPSSSDPIIS
AIKVLCSSQETGTAGNPYVEEPLVANSPQPSNASSITTTASSNSDSGIGFRDDCGNQSDR
ILVVDVQNQRLHIQQMVNSNCEVQQGNISGVNQPKSCMYGLTGSANSRLVKRPDDRLTVR
VMPDPVMNLSGTLAVSSHSRSPLSSSSSEGENHEQKSNPCIEIYSEQVDVPVYDFSSYCG
ETALSKNMATRSNDDMSVSSGTNKSQDQLNLQYKHNMYKNFMTNKTVSQCFHTNIKEKSV
NDANYNFPRFPLIVKSARSVGAMNIGSVQSHDAVLSCKLSPKVFGTPLRPMTHSLEDLKV
TEVPNDEKDPLAASLSLSSRGQHWGSLQDLRSFVVNCFEASPPPKDMNRPQLKKWGVATF
TATKTFVRATTGPRAGKRISRNLQRSSSDEGVFSKHEGHDPGVELLQEDERERGVASWAT
SFEKLLGDPAGLHTFAEFLKKEFSHENIYFWVACEKYRSLSSPTERTISARDIFERHLCL
GALEPVNVDSHARQATQDGLTDAASTLFLQAQKQIFNLMKFDSYPRFLKSDLYKECLVRE
LSGQELPFPGGDNLDTGLQLHGTGSYPSHSKLKKSRSDAEDRHRKSLLPWHRKNRSKSKD
RGESEYNKLRMLQQKHDTEDTVSVRSDVTSSRSSLASWDLALRGSFSRQSVTSGEGESCC
TLCRVILPDGATTVVQTRSSESVRDLVLRLLDKRGLHYSAFEVFDGTSVKPLSLDEDSTI
LAGKEVHVEQRAVFRLDLPNRKTVGVKAKIDKSLGEILRPILHKYGYKLELVTLCLMSEN
EVVEISAPVISVDSQRLQVLTRSAEAWKNEVAHTVASQHRLKVAGPTLDEITNRVFEELL
QGKATETTHTASDQGSIRSEDWGSEHSSGIFGRFLRRDSALLDKVRESRVKGKKAFGISK
HVGDESEAKVVPTSHPKPPLITKWKVGVKLQGRSESDELYEGLKRAQRSRLEDQRGTEIN
FELPDFLKDKENAPQTGKKFRKLRRGEENTSKVCEPSELHPESQHASNSQERLPAGTSGT
RCGYHTDRTTPGALVTRLLDQSFVAEGVIPSPHQAEEYFLGHRPDPNKLDKTHHGDISGA
GSSLENTLVELNPLEATLTCVDSRDEVNQGLNRLHQHSEPPPLPPKPKHLPLKTSMWESS
SNASGSTNPSTFRAPGDSANSRFLRPTEVKRDVRVCRSRRTVYLDQPSSSFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]