dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2K3DE08 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2K3DE08|A0A2K3DE08_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW78772.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_09g389652v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence length 397
Sequence
MATRGIAQLKAQYNRVRTSTALQGNSMWNNVIGIENEQKGTNSAIEAALHAPSYGGGHKA
QRMERAQALIEQAGYQPKATDLQGLLALAKSQGATGNATRGACKICGGLGHLTKKCKNGV
SGHTGDIGDLDAAAAVASMRALLPDPDEVSSLGSSDLDGSDLSDSDGDGGEKRKRKHSSS
KKEKKEKDKKRKKEKSSKKGKKERKEKKDKREKRDKKRRHEEDDREGSGKRARDESDSSS
DSGSDSDGDRRREKRRRSSRERDSKEREQRGGREEDAREERRGEGHEDRRGEGHEDRRGE
GREERRGEAREPEREREREHEREREREHGRGGGRDEGEREYDREAWRRMERQRGEREGGA
GGRNRDRDREERERGKEREQGRERDRSHERDGSRERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]