dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A2K5QZP0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A2K5QZP0|A0A2K5QZP0_CEBCA) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSCCAP00000021353} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=RGS12 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence length 1437
Sequence
MYRAGEAAKRPLPGPTPLRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGIGHFESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEELQSGGIFNMIFENPSLSASSSEPLRLKQRSLSESAAARFD
VGHESVNNPNPSMLSKEEISKVIHDDSVFSIGLEGHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLGTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFHHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAQQNNSTSS
NSDSGIGNFNQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGIPWTAPFCPDP
EGSPPFEAAHQTDRFRDLSKHLGPASPVELPPTSSRSSVPPSKRGTVGASSAFNQRWLPV
HVLREWQCGHTSDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSAPKREWSRKAF
GMQNIFGPHRNVRKTKEDKKGSKFGRGIGLTQPSPRTPARRSFGRSKRFSITRSLDDLES
ATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVR
YFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQEV
PSSPASKHSLGSEHSSVSTPKKLNGKSKSGRSLNEELGDEDSEKKRKGAFFLWSRTRSTG
RSQKKREHGDHTDDPLHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIH
LPDGTSCVVAVKAGFSIKEILSGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDL
RLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGGLLVRLSGEKEPLDL
GAPISSLDGQRVVLEEKDPSRGKASTDKQKGAPVKQNTAINSSSRNHSATGEERTLGKSN
SIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRG
LLRKEDLVLPEFLRLPPGSTELTLPTAAAMAKGFSKRGATGSGRESASQPSEQWEPAQES
SDSLSTSPGSAPSPPGTTSPGQKSPSGAFCTPQSPSSLEQEGTTQIWKRQSREVEARGIQ
TVEDEHVAELTLMGEGDISSPNSTLLPPPSAPQDALEPSRPGSRAHSSRGLPGNRIIDVD
LVTGSAPGRGGCTMGAWAGPGRSQVSSESPASDLPSLSPVPGEPAKPKASTHHATFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]