dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0JNC8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0JNC8|A0JNC8_BOVIN) BMP binding endothelial regulator {ECO:0000313|EMBL:AAI26621.1, ECO:0000313|Ensembl:ENSBTAP00000043607} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=BMPER OC=Pecora; Bovidae; Bovinae; Bos.
Sequence length 685
Sequence
MLWFSGVRALAERPCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCMNKEVTCKREKCPVLSRDCALAIKQRGACCERCKGCTYDGSTYNSSFK
WQNPAEPCVLRQCQEGVVTESEVRCVVHCKNPSKHLGTCCPTCPGCVFEGVQYQEGEEFQ
PEGDKCTKCSCVGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGSSFLYDNCTACTCKDSTVVCKKKCSHPGGCDRGEEACCDDCLLRVPQEDIKV
CKFGNKIFRDGEMWSSVNCTICACVKGKTECRKKQCVPISSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VDLVLGAGTVSLQQHLTVRWNGSRIALPCHAPQFHIDLDGYLLKVTTKAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGSFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYTTFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIRVHWEPQQNCAATQCKHGAVYDTCGPGCAKTCDNWNEIGPCNKPCV
AGCHCPANLVLHKGRCIKPVLCPQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]