dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A4TBU4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|A4TBU4|SYDND_MYCGI) Non-discriminating aspartyl-tRNA synthetase {ECO:0000255|HAMAP-Rule:MF_00044} KW=Complete proteome OX=350054 OS=(strain ATCC 700033 / PYR-GCK)). GN=Mflv_3785; OC=Mycobacterium.
Sequence length 590
Sequence
MLRTRTAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFRDGAVLEQAH
RLRSEFCVAVTGVVEIRPEGNANADIPTGEVEVNATSLTVLGESAALPFQLDETAGEEAR
LKYRYLDLRREVPGNAIRLRSKVNAAARGVLAGHDFVEIETPTLTRSTPEGARDFLVPAR
LQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDA
DDVMALSEEVLRAVWATIGYDLPLPLPRISYADAMRRFGSDKPDLRFGLELVECTEYFAD
TPFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGKDGELTGPVAKN
LTDAERAGLTAHVGANPGDCVFFAAGTAKSARALLGATRIEVAKRLDLIDPDAWAFTWVV
DWPMFESAAEATASGDVAVGSGAWTAMHHAFTAPTPESEATFDTDPGSALSNAYDIVCNG
NEIGGGSLRIHRRDVQERVFAMMGISQEEAEDKFGFLLEAFTFGAPPHGGIAFGWDRIVA
LLAGLDSIREVIAFPKSGGGVDPLTEAPAPITAQQRKESGIDAKPGKDGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]