dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A4X7L8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A4X7L8|A4X7L8_SALTO) Uncharacterized protein {ECO:0000313|EMBL:ABP54868.1} KW=Complete proteome; Reference proteome OX=369723 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440). GN=Strop_2421 OC=Salinispora.
Sequence length 163
Sequence
MGEAFTVEPIAHVVGGRTEPTDDYWGGVRAIVRIDEKRFTPESAKGLDAFSHLEVVFRFH
LTDPTDLNLGARRPRDNPDWPEVGIFGHRNMRRINWLGVSRCRLLKVDGLDLHVEGLDAV
DSTPVLDIKPWFVEFGPRGEVFQAHWTTDMLGHYFAAQSPRKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]