dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A6W036 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A6W036|A6W036_MARMS) Sulfite reductase (Ferredoxin) {ECO:0000313|EMBL:ABR72065.1} KW=Complete proteome; Reference proteome OX=400668 OS=Marinomonas sp. (strain MWYL1). GN=Mmwyl1_3156 OC=Oceanospirillaceae; Marinomonas.
Sequence length 552
Sequence
MYRYDEYDRALVNERVEEFRDQVARRMSGELTEDEFLPLRLQNGLYLQKHAYMMRVAIPY
GALSSDQMRGLAVIANEFDRGYGHFTTRQNIQFNWIELADTPDILAHLASIDMHAIQTSG
NCVRNVTTEAYAGVAPDEEYDPRIFAEIIRQWATVNPEFLFLPRKFKIAVSSSKEDRAAV
RMHDIGLYLYRDEEEILRFQVMVGGGLGRTPFLNKAVKEDLHWSEVLSYIEAVLRVFNRY
GRRDNKYKARIKILVNSLGVDAFREEVEAEWLQIREGFSTLTDDELSRVASQFLSPLYKT
LDDTDLRYGNHIASNDEFASWVSRSVKPHKVSGYASVVISTKFPTNTPGDLNAEQMQRIA
DLADLYGFGVIRIAHEQNVVLPDIPKKYLFNVWSSLCEVGLALPNVGLVSDMIVCPGASY
CSLATAHSFPVAKKVAEAYSIEEQLEVGDISINLSGCINACAHHHIGNIGILGLNKSGED
YYQITIGGAQGKDSQIGKVIGPAVSEDVLPRVVKNITNAYLANRDESETFHETFLRIGLE
PFKLAAYESVGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]