dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A9BQP4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A9BQP4|A9BQP4_DELAS) Succinic semialdehyde dehydrogenase {ECO:0000313|EMBL:ABX32746.1} KW=Complete proteome; Reference proteome OX=398578 OS=Delftia acidovorans (strain DSM 14801 / SPH-1). GN=Daci_0100 OC=Comamonadaceae; Delftia.
Sequence length 484
Sequence
MPLALRDPSLLKNLCLIDGQWLAADDGSRIDVHNPATGEAVGHVPRMGEAETQRAIAAAE
RAFALWKQQTAEARARLLQRWFELMMENQEDLALIMTSEQGKPLAESRGEIAYAASYVQW
FAEEARRIYGSTVPAPWADKRIIVTKEPVGVCAAITPWNFPAAMITRKVAPALAAGCTII
VKPAQQTPLSALAMAELAQRAGIPEGVFSVITGSSRAIGGVLTASMAVRKLTFTGSTEVG
RVLAEQCAPTLKKMSLELGGNAPFIVFDDADLDAAVEGAMASKYRNTGQTCVCANRLLVQ
DGVYDAFMARLKVAVQALKVGNGLEAGVGQGPLIDQAAVDKVEELVADAVKNGAEVVLGG
KRHALGGTFYEPTILANATDRMRIAREEVFGPVAPVFRFKTEEEAIRMANDTEYGLAAYF
YARDVGRVWRVGEALEYGMVGINSGIISTAVAPFGGVKQSGMGREGGAAGIEEYLSTKYL
CMGH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]