dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A9SJY6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A9SJY6|A9SJY6_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ68541.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_80431 OC=Physcomitrella.
Sequence length 309
Sequence
MFVKEVQSATIVASLERAKIWEECHYDQYLTVGATMIPSQGGYQMTNWNDASKSYPGRSD
YGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKPIPTKELTNELISRDPNESLLLTLKKK
MDELAVNLAKDKEKRHKPTNMRPNVWCSNCKGQGHLVTECSSPPQMMVQCTFCGGKHTTA
NCWNLRKQQVGQQTMSQPTSWDVNQHMQTSQPAEDKGPVQRDSPVHRVEVVNAVLTKGQQ
KGKNPIQDLDDPIEVTTVALSKRRTEPISVLGRIPILSPQQDEESTSVSRANFSGTSRSI
PNDHIPIPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]