dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A9TEN1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A9TEN1|A9TEN1_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ58059.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_029403 OC=Physcomitrella.
Sequence length 616
Sequence
MAVHEGQLEATEQNGGNQQRGAEEEEEDIEEYVPVKKRRLMAAQQLLNKKAVKGANGANM
TSTLDEQEGLKSSEIKPSLLVKSSQLKKDAPEISVTEALVMQEKEMIERLSEKKHLVPVR
ELAKGISYTEPMQTGWKPPLAIRNLSEKDCKDIRRQWHILVEGDEIPPPIKNFKDMRFPD
PILKKLKAKGITRPTPIQVQGLPVILSGRDMIGIAFTGSGKTLVFVLPLIMLALQEEVRM
PLIGGEGPFGLVVCPSRELARQTYDVVEEFTAVLSEKGYPQLRSMLCIGGIDMRSQLEVV
KHGVHIVVATPGRLKDMLAKKKMNLDNCKYLTLDEADRLVDLGFEEDIREVFDHFRGQRQ
TLLFSATMPKKIQNFAKSALVKPVVVNVGRAGAANLDVIQEVEYVKQEAKIVYLLECLQK
TPPPVLIFCENKADVDDIHEYLLLKGVEAVAIHGGKDQEEREFAIASFKAGKKDVLVATD
VASKGLDFPDIQHVINYDMPAEIENYVHRIGRTGRCGKTGIATSFINKNQSETILLDLKH
LLKEAKQRIPPVLATLDDPMEEAEELAKASGVKGCAYCGGLGHRISECPKLEHQKSQAIA
GTRRDYFGSGGYGGEI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]