dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A9TNB3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A9TNB3|A9TNB3_PHYPA) Eukaryotic translation initiation factor 3 subunit 4 {ECO:0000256|HAMAP-Rule:MF_03006} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_020058 OC=Physcomitrella.
Sequence length 288
Sequence
MGGRRNLRWGDAAEEDDEIEGVLPPTQVFGPDEKGVKIIIEWKKNDDNVRTKVIKTIRVK
KQMKKLNPATIRRRSLGKFGDALGQNASDNLTVVSTEEIFLERTRPAGAKAEPEKGADLA
SLGNASLIVCRTCGKKGDHWTSKCPFKELAASRGIIAGGEKPPTDDNVPGISAGAGGKGS
YVPPSMRYGKGNEGESMKRPGRDDNSIRVTNLSEDTREQDLQELFSPFGSISRIYVAFDR
ETGLSRGFAFINFVNRDDAIRAINKLDGYGYDNLILRVEWATPRADRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]