dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B1I568 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B1I568|B1I568_DESAP) Peptidase S55, SpoIVB {ECO:0000313|EMBL:ACA60118.1} KW=Complete proteome; Reference proteome OX=477974 OS=Desulforudis audaxviator (strain MP104C). GN=Daud_1616 OC=Candidatus Desulforudis.
Sequence length 440
Sequence
MPGSIRKRISQAGFIFFAILLIFGCFTPFSRSFFGLPVYQNILVGESVAPSLQVPGSLKS
VLQWESDRPEAIRLLETGGSPVIREAGEYRLSLKLFGFIPLRHLTVSAVPEVKVLPGGQS
IGVLLHSRGVIVIGEAPLESGEREYSPAYQAGIREGDVILSINGREVRCEADVREMVNEV
GGNGERLAVRLKRNGVEFLVGVTPDYCERTGRYRVGLLVRDSAAGVGTLTFHDPKTGSYG
ALGHVITDGRSPQRLELTDGRIVEAEIRGVHPGMRGRPGEKLGAFAGEGSFTGSIDRNTT
YGIFGTLEGNISNPYFREPIPVALLHHVRPGPAVMLTVLHDRQIERFNLMIEEVRPENGG
DGKGLVIRIDDERLLERSGGIIQGMSGSPIIQNGRLVGAVTHVFINNPSRGYGVPIEWML
RESGLLKKPTEVSIQWRKVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]