dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B1KKK9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B1KKK9|B1KKK9_SHEWM) Peptidase M14 carboxypeptidase A {ECO:0000313|EMBL:ACA87226.1} KW=Complete proteome; Reference proteome OX=392500 OS=Shewanella woodyi (strain ATCC 51908 / MS32). GN=Swoo_2953 OC=Shewanellaceae; Shewanella.
Sequence length 773
Sequence
MAEITMKTAESIARLTKGITLSRLTKSLIISGLIFSSLAQSQAQAIDDSQQTYKVTFPDE
QTFLKANISLHNEKIKTDPTQRAIWVPLSSDELSRLKPFATSMAKVDDPASLYPQKIASQ
SNLLSGIPGYSCYPTVEETQTDIEQLVSQNPNFATIEDIGDSWQKQAGNGGYDLNLLKLT
NSQVTGDKPKLFIHAAMHAREYATSPLVLQFAKDLLSERDTDADSQWLLDRHEIHLLLHM
NPDGRKKAETGLSWRKNANQNYCGSNPNAIGTDLNRNFSWGWNTVEQGSSGNECSNIFRG
PSAGSEPETQAVEAYVRALFGDHRGPNRTDAAPDTTQGLHIDVHSYSELVLWPWGGTNAL
APNGAAMRTLGRKLARFNGYMPMQSVGLYPTDGTSDNLSYGELGIPHMTFELGTDFFQSC
SSYNDKVLPDNLKALKYAAKIVEAPYLIPSGPDITEISSVGQPLNAIAQNYRVTLKVTAS
DDRFSRRGGTEATQDIAEIALYIDDAPWDGGQATLLTATDGSFDEKTEQGELQLNANDLS
LGQHTLYLKAKDTSGQWGALSAQFIQVIAPQANQAPQANFSFQCDEFTCQFDASSSADPE
GDSLSYAWQLGTGTSREAQPSYQFSSSELTDNKVEVTLTVSDPQGLSHSQTQHLTLSANQ
APKASFTASCTHLVCQIDASASSDPDADTLSYQWQLGDGNSSDKLQLTHSYTQAGTYNIV
LTVSDGKTDNSSEKSVTVTVAPTPEPSENGSSGGAIGLFSLLLLALGIRRQTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]