dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B2J4Q8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|B2J4Q8|CHEB_NOSP7) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000255|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_R0244; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence length 354
Sequence
MRIAIVNDTAMAVEALKRVLLTVPGHEISWIARDGTEAVARCARDTPDLILMDLFMPVMD
GVEATRQIMKQSPCAIIIVTASVSKNAGKVFEAMGYGARDAVNVPILGTQESSDSAQLLL
TKIATIAKLIGKSSPTSTPKPQTAKLTSFSTHSTLLPPLVAIGSSTGGPKALAAILSRLP
ANFGAAIAIVQHVDMQFSAGLVDWLNQQTALTVQLATVGDRFEKGIVLVAGTNDHLSLHS
DLTLHYTKEPIDYPYRPSVDVFFKSLAQYWNAKGTAVLLTGMGQDGAQGLSLLRSRGWHT
IAQDEKSSVVYGMPKAAVQLNAAVEILPPEAIATSLIQQIMFRKSGVPKSDTRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]