dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B4KT34 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B4KT34|B4KT34_DROMO) Uncharacterized protein {ECO:0000313|EMBL:EDW09554.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI18973 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence length 286
Sequence
MEQTQITDAEKVRIVSEFILHAPPGEFNEVFNDVRELLKNDSLLKDGASHAFSQYNKDQL
TPVRVEGSEHNAIISEYNDLGNGRFFDPRTKQSFKYDHLRKEASDYQDLKADANAESWRA
ALDLATLAYTANHYRHGVCSVFGKSQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVSFQ
PGCGLAELKGVLKVQVHYYEDGNVQLVSSKDCRESVVVSNEQQLANEVIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITKTKIDWSKIVSYSIGKELKTQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]