dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B4MP99 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B4MP99|B4MP99_DROWI) GK21647 {ECO:0000313|EMBL:EDW73938.1} KW=Complete proteome; Reference proteome OX=7260 OS=Drosophila willistoni (Fruit fly). GN=Dwil_GK21647 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 244
Sequence
MEGHIKRLINGAYFDPDVLCEMEESVPYSLNIDEFWHHTLPFVHKIFVVLLTNLNTGHMK
LVYAANCCPSARTETKRFLTDSEEVAVTLLKVMYQVPPCRLKNIVALVSDRNKMNVRALE
DAEKMLGRNLPPVIFDSTQIASKFNMEKDPFTRASMEEILATLFKRESYKSQLDDIETMC
NGSNYKTLQLLWGFSTSLEKILKKVFDIDASITTFNVGHLSNDKLEAYGRSAVSQINLSF
SKLL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]