dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B6GXT2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B6GXT2|B6GXT2_PENRW) Pc12g15550 protein {ECO:0000313|EMBL:CAP81182.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc12g15550 OC=Penicillium chrysogenum species complex.
Sequence length 199
Sequence
MSNASDLRYVRYDNSRENEYVAAMRQLISKDLSEPYSIYVYRYFLYQWGDLCFLAMDDKD
EMVGVVVSKLEPHRDGPLRGYIAMLAVREENRGRGIATKLVRMAIDAMIERDADEIVLET
EITNTGAMKLYERLGFLRSKQLHRYYLNGNSAYRLVLYLKEGVGSIRTTFVDPYGLPPPV
PGLPDTCGGHSHANMGSLI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]