dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B7KUN3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B7KUN3|B7KUN3_METC4) L-threonine aldolase {ECO:0000256|PIRNR:PIRNR038940} KW=Complete proteome OX=440085 OS=(Methylobacterium chloromethanicum). GN=Mchl_3442 OC=Methylobacteriaceae; Methylobacterium.
Sequence length 346
Sequence
MAEQQFASDNYAGICPEALTAMQAANAGHAPAYGADTWTQAAADGFRRLFETDCEVFFVF
NGTAANSLALASLCQSYHSVICADSAHIETDECGAPEFFSNGSKLLTAATDDGKLTPEIV
RTIAGKRSDIHFPKPRAVTLTQATETGRVYSLDEIAAISAVCRALGLRLHMDGARFANAC
ASLDASPAELTWKAGVDVLCFGGTKNGMAVGEAVIFFDRKLAEDFDYRCKQAGQLASKMR
YLSAPWVGMLENGAWLDNARHANECARRLVRGIADVPGISLAAPVEANGVFLNLPAPVQE
GLRARGWQFYGFIGGASRFMFAWDSEPARVDALAQDIRLCALPAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]