dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B8GKD0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B8GKD0|B8GKD0_METPE) D-3-phosphoglycerate dehydrogenase {ECO:0000256|RuleBase:RU363003} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_0439 OC=Methanoregulaceae; Methanosphaerula.
Sequence length 532
Sequence
MGIIVNYRVLVSDPLAEEGLTILRDQVEVDVKTGLTEDQLIAIIDQYDALLVRSGTQVTA
KVIEAGTHLKFIGRAGVGVDNIDTDAATRQGIIVANAPEGNTLAATEHTVAMMMALARNI
PQANASVKRHEWKRSKFTGIEVNEKVLGVVGFGRIGKEVAKRAIAMNMRIVAYDPFISKE
KAAEIGVEIMTMAELFTVADFITVHTPLMKETTHIINDASIATMKDGVRIINCARGGIID
EQALYRGLVSGKIGGAALDVYEHEPPTDSPLIELDQVIMTPHLGASTVEAQINVAISVAK
QCLSVLSGGSARSAVNAPMIPADQLEFVEPFAVLAEKMGRLLLQLVEGRLEAIELVYGGE
FVERNSNTRFITRMALKGILDRLLHLPVNIVNAEFVAHERGIVVSQTVTRESQGFKNLIT
IKVRTDLGEETISGSVFSKVRSRIVAIGGYTMDLDPTGFLVISRHLDKPGVIGRASTILG
HCEVNIAGMQVGRIRPGEEAIMVLNVDSEVSDEAMDEIRSMPGIFSAKFAQI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]