dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

B8PI38 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|B8PI38|B8PI38_POSPM) Predicted protein {ECO:0000313|EMBL:EED79456.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_93607 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence length 642
Sequence
MRARTRGANGCAWPSTNHNFLRCYAPGNIIFLRRDLRELWETNRLLIIPHPDHLQKLKYC
PVSGTISSRKTCWWCSGRLLNFWPARDIIRWRWAFSSCHPNDRTQYCSPLLDDETVRFCR
QFRPILLGIKRRCFGDTSASSQDYIGDAEREVGIRPPAEFEDAEMLAYRQEQAGDVQPVV
QKCIPLQYPWFSGYRLQKHRSNPKFDLVIHSSLCSSLLGVVVVDFWSTWFLWDYQLSQDH
CSSSTTEQISASSPPPKGLPYTLKAAPGVAPPVQTRRSSPIKNSLATTRDTHPLTQKTYS
PSYGSTSNLRKQQKVHSHPSTNNHSNSLKFTPPAPTNAPVEVPMAMFTQEDINQRIAVTL
TAYQSQQSTANRPLHLDIPAPEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTV
ALMRKDLGKTWADTYYEKSAGGVQVYSTWADFVAALEEVFPEHGTRIKAHQILMKLPERQ
KDRKTALSLGNYVTRFEQLASKAQLKDTEVNGTNCIENDYHTLHANFGALVITDTRDYGE
PMDIDAAAVASTFASTSGGRKWELGAVLNKADQKLHRDGNLCFYCHIKGHSAKDCRKKAA
ARQGGGRPNQGGSGKDDFCARIKTLSADEKRELYEELMMEDF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]